PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_8075_iso_7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 457aa    MW: 51552.1 Da    PI: 6.5192
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_8075_iso_7genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.63.2e-143175348
                                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         +W++eEd++l + ++ +G+++W+ Ia+++   +t  qc+ rw++yl
  cra_locus_8075_iso_7_len_2228_ver_3 31 SWSQEEDDILREQIRIHGTENWAIIASKFK-DKTTRQCRRRWFTYL 75
                                         6****************************9.*************97 PP

2Myb_DNA-binding43.57.3e-1481124146
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                          rg W++eEd ll +a k +G++ W+ Ia+ +  gRt++ +k+r+ +
  cra_locus_8075_iso_7_len_2228_ver_3  81 RGGWSPEEDMLLCEAQKVFGNR-WTEIAKVVS-GRTDNAVKNRFTT 124
                                          789*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.5672475IPR017930Myb domain
SMARTSM007176.0E-132877IPR001005SANT/Myb domain
SuperFamilySSF466899.36E-2629122IPR009057Homeodomain-like
CDDcd001671.69E-123175No hitNo description
Gene3DG3DSA:1.10.10.601.8E-203282IPR009057Homeodomain-like
PfamPF139212.2E-143292No hitNo description
PROSITE profilePS5129419.94576130IPR017930Myb domain
SMARTSM007171.2E-1480128IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-1983129IPR009057Homeodomain-like
CDDcd001671.18E-1084125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MQSVVKKKAT TSSDGNSGQQ VPKQKERHIV SWSQEEDDIL REQIRIHGTE NWAIIASKFK  60
DKTTRQCRRR WFTYLNSDFK RGGWSPEEDM LLCEAQKVFG NRWTEIAKVV SGRTDNAVKN  120
RFTTLCKKRA KHEALAKENK NASFINLNNK RVIFPIGLNT DGTSEAAGPL KKRRSHIPDP  180
SENGNHDEKL LGESGTATQS LRHPFAVLAQ NSHRTGSNLS TQQNVNDIKE TPVDGCNSKI  240
QGTFLKKDDP KILALMQQAE LLSSLAAKVN SENTDQSLES AWKVLQDFLN QPKESDEVSF  300
RISEMSFQLE NIKDLIEDLQ GSNDCSRQSW RQPDLYEESS ASSDYSTGST LPSNAQSDKT  360
EQIQSDISGQ YPGIEPDLQP PHAGHLHGLA EGEQEMSCDQ TADQXXXXXX XXXXXXXXXX  420
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXP AQNFRKV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-263213010108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1171175KRRSH
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00259DAPTransfer from AT2G02820Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015076726.11e-179PREDICTED: myb-related protein A isoform X2
TrEMBLA0A068TVN30.0A0A068TVN3_COFCA; Uncharacterized protein
STRINGSolyc05g007160.2.11e-178(Solanum lycopersicum)